PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan020145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family HB-other
Protein Properties Length: 264aa    MW: 29326.5 Da    PI: 9.0646
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-164160990PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.4e-21123178156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                r+k +++t++q++eLe+ F+ n++p+++er  L kkl+L+ +qVk+WFqNrR+++k
  Aan020145 123 RQKYHRHTPYQIQELEASFKDNPHPDEKERLALGKKLNLENKQVKFWFQNRRTQMK 178
                678899***********************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-2298182IPR009057Homeodomain-like
SuperFamilySSF466898.13E-21108180IPR009057Homeodomain-like
PROSITE profilePS5007117.815120180IPR001356Homeobox domain
SMARTSM003897.2E-18121184IPR001356Homeobox domain
PfamPF000461.5E-18123178IPR001356Homeobox domain
CDDcd000868.27E-18123180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
RVSSFGGFYG GGGGGGGSDS RMMVSDGSFN TMPMQGLPFS QPQLITSTIN QPIYNSQSLS  60
LALKPKMEGL GEMGLIGENF EGNLGRVRGD GSESRSGGSD NLEGASGDEQ DVPVGPSSSS  120
RRRQKYHRHT PYQIQELEAS FKDNPHPDEK ERLALGKKLN LENKQVKFWF QNRRTQMKTQ  180
LERHENAILK QENDKLRIEN IAMKEAIRAP VCNNCGGQAI LGDISIDEHH LRIENARLRD  240
ELSRISILAN KFXRKAFYPL LAVX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016468062.11e-106PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X2
RefseqXP_016468061.11e-106PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X1
SwissprotQ0WV125e-76ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A118K2P71e-157A0A118K2P7_CYNCS; Homeodomain-containing protein
STRINGPGSC0003DMT4000370551e-93(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-70HD-ZIP family protein